PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 285aa    MW: 32066.2 Da    PI: 6.2701
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59970.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.2e-193274145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +g+WT+eEde+l++++k+lG++ W+ Ia+ ++ gRt++ +k++w+
       EPS59970.1 32 KGAWTQEEDEILAQYHKKLGNK-WAEIAKFLP-GRTDNGIKNHWH 74
                     79********************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-52135IPR009057Homeodomain-like
SuperFamilySSF466896.81E-222281IPR009057Homeodomain-like
PROSITE profilePS5129427.3672781IPR017930Myb domain
SMARTSM007171.1E-163179IPR001005SANT/Myb domain
PfamPF002495.6E-173274IPR001005SANT/Myb domain
CDDcd001672.57E-133474No hitNo description
Gene3DG3DSA:1.10.10.602.2E-213681IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
METSNHALGL FHLRVYNQLR IWHNHLDPSI KKGAWTQEED EILAQYHKKL GNKWAEIAKF  60
LPGRTDNGIK NHWHCSLKKR LDLNLPCFPA EDDRGSRHNI PGRLKQCPQR SSSSLVEYST  120
SSSVPSFRDD GASHSDSSKK YAAYHPYPSL GHYFNGMKNL MKKYDGSNSS PVDTGLSLSL  180
SGSNKSGGEA SKRRRVDGEM SFAVKQESLD DVQTRQQQNS HLDPTDDDDD DDDDLSLSIS  240
VKVCSPESVA RDSTLSCSNV GVERRLEHEF DLEFWDSSTH DAPDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-24228146105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-24228146105C-Myb DNA-Binding Domain
1msf_C2e-24228146105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191195KRRRV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLS8BZH70.0S8BZH7_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA103932025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.13e-25myb domain protein 3r-4
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]